DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and Cpr47Ee

DIOPT Version :10

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:71 Identity:23/71 - (32%)
Similarity:36/71 - (50%) Gaps:11/71 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GHYSFEFQTTNGITTKGAG-------NENGAVGVVQ----FVSPEGIPVTFSYVADANGYQPTGD 97
            |.:|:.:.:.:|.|.:..|       .|.....|:|    :.||||.|:|..|:||.||::..|.
  Fly   118 GSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGT 182

  Fly    98 HIPAIP 103
            .||:.|
  Fly   183 GIPSSP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 17/56 (30%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:459790 17/56 (30%)

Return to query results.
Submit another query.