DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and CG17803

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:358 Identity:79/358 - (22%)
Similarity:136/358 - (37%) Gaps:69/358 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LENDVER---VKTN-----LISLLNKKYAINEDMGQ--EGSPPLKMQKMVGGSANRSLEESPSAD 198
            |:.|.|:   ::.|     :||:  :|....|::|:  .|:   |:.|:|.|..|...|.:|...
  Fly   234 LDRDTEKDFALEQNKSCNEIISI--RKCKTKEEIGKVDHGA---KVYKVVLGEYNSLKETAPKYS 293

  Fly   199 LLRPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKATKIYKCTSCDY---KTSDMRLFNTHYET 260
            |..|:|       .|.:::|  .:.:.:..:.:|.|... |.|..|.:   :.|.:::....:..
  Fly   294 LSLPKK-------PQLRVSP--EEKNRRRRERIQAKPLN-YVCDKCGHTFRQRSQLQMHLLRHNR 348

  Fly   261 CKQQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDNTCAMCHINFVNENSLRKHMETNHATNVLVT 325
            .|  .|:|..|.|.|........|:...|.......|..|:.:|.|.:|..:|....|.      
  Fly   349 AK--NFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHG------ 405

  Fly   326 STTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFKSTDKVVFDEHMRKHAAGKPKPFKC 390
                        |.........:.|.  |:|.:.|..|....|.|.....||..|...  :||:|
  Fly   406 ------------AGNRIRTRVKSKEE--GSSRHYCTQCTKSYTSKKGLVLHMNFHNGS--RPFQC 454

  Fly   391 RLCSQRFETREAATVHAKQHQTNFFKCGTCSMTFPKREMLVKHFEVH--QSPSASTVSP-----K 448
            ::|..:|....|...|...|.....:|..|...|..|..|.||.:||  ..|....:..     :
  Fly   455 KICQMKFADPSAMKRHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHR 519

  Fly   449 QSVSQNLNT-------QKLLQETID---EALSD 471
            .:::::.||       ||.::|.::   :|..|
  Fly   520 YNLNKHKNTDLHRDNMQKAIKEEVNGLQQAFKD 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 3/24 (13%)
C2H2 Zn finger 268..289 CDD:275371 5/20 (25%)
C2H2 Zn finger 297..318 CDD:275371 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
zf-H2C2_2 373..399 CDD:290200 8/25 (32%)
zf-C2H2_8 375..443 CDD:292531 21/69 (30%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..437 CDD:275368 7/19 (37%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 48/229 (21%)
zf-C2H2 324..346 CDD:278523 4/21 (19%)
C2H2 Zn finger 326..346 CDD:275368 3/19 (16%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 6/17 (35%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 0/18 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.