DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and CG6254

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:546 Identity:105/546 - (19%)
Similarity:184/546 - (33%) Gaps:141/546 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 MCTTHTSTKFPNKLAQLVGEGFLV---------------IVCGEDYVCSRCTNLV----NYYDRL 144
            :|.|.||:|..:::  |:...|||               .|..|:...|.....:    ...|..
  Fly   151 VCQTETSSKMKSEI--LMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQISGVEEEILEEDVEEDLA 213

  Fly   145 ENDVERVKTNLISLLNKKYAINEDMGQEGSPPLKMQKMVGGSANRSLEESP-------SADLLRP 202
            |.:||.|:..:.::..:..|:.|::..:.:....::::...:.:|.:|||.       |...:..
  Fly   214 EEEVETVEEEIDTVGEEVEAVEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNMET 278

  Fly   203 RKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKATK---------------IYKCTSCD------- 245
            .:::|.|| .:..:....|..|::..:..|...::               :|||..|.       
  Fly   279 YEIVQHNP-QKEPVETKDTVESIESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPK 342

  Fly   246 -YKTSDMRLFNTHYETCKQQTFQCKTCRKIFPHFGAMKQHMVRDHNTA---MDNTCAMCHINFVN 306
             ||.....:.||..:...|  .:|..|:..||....:..|. |.|..|   .||.|..|...|..
  Fly   343 AYKRHMEEVHNTVADDLPQ--LECNQCKLCFPTVAQLHAHH-RTHVRAKPKTDNCCPHCEKRFTT 404

  Fly   307 ENSLRKHMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFKSTDKV 371
            ..:|::|:|..|                              |:    ...|.|:.|. ||.:.:
  Fly   405 SGTLKRHIEGIH------------------------------NQ----IKPYVCDLCG-KSFNYI 434

  Fly   372 V-FDEHMRKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNFFKCGTCSMTFPKREMLVKHFE 435
            . ..:|...|.  ...||:|.:|.:.|:......:|...|....::|..|.:....|....||..
  Fly   435 TGLKDHKLVHT--DECPFECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKL 497

  Fly   436 VHQSPSASTVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNIRFFSCSICSL 500
            ||.                 :|::...|....|...|.......::.|     .||.:.|:.|..
  Fly   498 VHS-----------------DTRQFKCEVCGSAFKRSKTLKAHLILHT-----GIRPYKCNFCGR 540

  Fly   501 TFIQ-ETYYNHHMETHRRDKKATSA-GATALN--------SAATALLSDEPGEATGKA------- 548
            .|.. ....:|..:.|.::.....| |.|...        :.|:.||....|....|.       
  Fly   541 DFANGSNCRSHKRQAHPKELAEEEARGVTRSTLLPMLDELTIASKLLKTPAGPCKVKGSRPKAAP 605

  Fly   549 -----GDESGEQNAE-ADIESLFEKL 568
                 |:||..::.: |.:..|.|:|
  Fly   606 KDQDNGNESPTKDTDGAILYELVEEL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 6/29 (21%)
C2H2 Zn finger 268..289 CDD:275371 6/20 (30%)
C2H2 Zn finger 297..318 CDD:275371 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 5/20 (25%)
zf-H2C2_2 373..399 CDD:290200 7/25 (28%)
zf-C2H2_8 375..443 CDD:292531 16/67 (24%)
C2H2 Zn finger 390..410 CDD:275368 4/19 (21%)
C2H2 Zn finger 417..437 CDD:275368 5/19 (26%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 53/262 (20%)
C2H2 Zn finger 364..384 CDD:275368 6/20 (30%)
C2H2 Zn finger 395..416 CDD:275368 6/20 (30%)
C2H2 Zn finger 424..444 CDD:275368 5/20 (25%)
C2H2 Zn finger 452..472 CDD:275368 4/19 (21%)
C2H2 Zn finger 479..499 CDD:275368 5/19 (26%)
C2H2 Zn finger 507..527 CDD:275368 3/19 (16%)
zf-H2C2_2 520..544 CDD:290200 6/28 (21%)
C2H2 Zn finger 535..553 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.