DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and CG8089

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:588 Identity:110/588 - (18%)
Similarity:184/588 - (31%) Gaps:162/588 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YICDDRCEPQTSLTDMCTTHTSTKFPNKLAQLVGEGFLVIVCGEDYVCSRCTNLVNYYDRLENDV 148
            |.|...|.        |.......|..|.....|||..:.  |.|:....|           .||
  Fly    28 YGCPASCH--------CKCKCCRGFREKYVAFNGEGETIF--GTDFSSELC-----------EDV 71

  Fly   149 ERV----KTNLISL-----LNKKYAINE--------------DMGQEGSPPLKMQKM------VG 184
            :::    .::::.|     |...:..||              |..:|.:..::::|:      |.
  Fly    72 QKIMRFRSSDMLLLLRTAQLRDNFWTNEYFKADLQDDFRAIFDAFEEKNRKVQLEKLAAILDTVS 136

  Fly   185 GSANRSLEESPSAD---LLRPRKLLQGNPVGQSKIA----PGTTQSSVQGTQTVQRKATKIYKCT 242
            ....||:.:....:   .|||            |||    ||.              ....|||.
  Fly   137 SGYRRSVSQLAGQEAHGALRP------------KIAALFLPGL--------------RCDCYKCE 175

  Fly   243 SCDYKTSDMRLFNTHYETCK-QQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDNTCAMCHINFVN 306
            :..:|  .::....|.:|.: ...|.|:.|.:.|....::..|::|...::.:          ::
  Fly   176 NLPWK--KLQDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSHIIRKSTSSRE----------LH 228

  Fly   307 ENSLRKHMETNHAT---NVLVTSTTTIPASAAPVAAAAAAAAAAANENLV----GTSLYTCNHCQ 364
            ||...|.:..|..:   ..|..|...:.....|||....:.....:::.:    .:||..|..|.
  Fly   229 ENKRYKRLLENQKSQEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLSKCPSCA 293

  Fly   365 FKSTDKVVFDEHMRKHAAGK---PKPFKCRLCSQRFETREAATVHAKQHQT------NFFKCGTC 420
            ...........||.||...:   ..||.|..|::.|.||:....|.::.:|      ..|||..|
  Fly   294 QNYGFSFSHQLHMVKHRRERLYTNFPFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHC 358

  Fly   421 SMTFPKREMLVKH-FEVHQ--SPSASTVSPKQSVSQNLNTQK----LLQETIDEALSDSLPASTA 478
            :..|..:..|..| ..:|:  .|......|...:..:.:|.|    .:|:..|:......|....
  Fly   359 TWRFQLKSALDSHVLRIHERRKPCLICKLPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKGG 423

  Fly   479 AVVATT---------------------ESENNIRFFSCSICSLTFIQETYYNHHMETHRRDKKAT 522
            .....|                     ::..|.|.|:|.||...|    |....|:|||   ||.
  Fly   424 CRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANF----YSQGTMQTHR---KAV 481

  Fly   523 SAGATALNSAATALLSDEPGE---------------ATGKAGDESGEQNAEADIESLFEKLHSDK 572
            ......:......|.....|.               ..||..|::.:.|......:..|||..:.
  Fly   482 HLLVHTVQCEVCDLTIKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSNRRKGARTTDEKLDIEA 546

  Fly   573 NES 575
            :.|
  Fly   547 SSS 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 4/22 (18%)
C2H2 Zn finger 268..289 CDD:275371 5/20 (25%)
C2H2 Zn finger 297..318 CDD:275371 3/20 (15%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
zf-H2C2_2 373..399 CDD:290200 9/28 (32%)
zf-C2H2_8 375..443 CDD:292531 22/79 (28%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..437 CDD:275368 5/20 (25%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
C2H2 Zn finger 322..343 CDD:275368 6/20 (30%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 432..453 CDD:275368 0/20 (0%)
C2H2 Zn finger 461..486 CDD:275368 11/31 (35%)
C2H2 Zn finger 490..506 CDD:275368 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.