DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and az2

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:473 Identity:89/473 - (18%)
Similarity:140/473 - (29%) Gaps:171/473 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YVCSRC-TNLVNYYDRLENDVERVKTNLISL-LNKKYAINEDMGQEGSPPLKMQKMVGGSANRSL 191
            |...:| |:|...|..:....:..|...:.| .:.||:...:.|                   ||
  Fly   203 YKLKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERG-------------------SL 248

  Fly   192 EESPSADLLRPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQ---------------------RKA 235
            |::.|.|:           .|..||....|:.:...||.:.                     ||:
  Fly   249 EDADSDDV-----------DGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAHKHFCNLNVRKS 302

  Fly   236 TKIYKCTSCDYKTSDMRL-FNTHY------------------------------------ETCK- 262
            :.|   ...|..||:..| ..|||                                    |.|. 
  Fly   303 SLI---EITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNS 364

  Fly   263 -------QQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDN--TCAMCHINFVNENSLRKHMETNH 318
                   :|..:|:.|...|....|::.|..|||......  .|.:|.:||..:..|::|.:..|
  Fly   365 FMPTKSFRQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVH 429

  Fly   319 ATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHC--QFKSTDKVVFDE--HMRK 379
            .....|                                   |..|  .|...:::...:  |..|
  Fly   430 MDKSFV-----------------------------------CEICSRSFAFGNQLAIHKRTHDEK 459

  Fly   380 HAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNF--FKCGTCSMTFPKREMLVKHFEVHQSPSA 442
            |.|   |||.|..|.:.|:.:...|.|.....|..  |||..|...|..:..|..|.:.|     
  Fly   460 HVA---KPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAH----- 516

  Fly   443 STVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNIRFFSCSICSLTFIQETY 507
                        ||.:..:.|...:|.::      |..:......:..:...||:|:..|.:...
  Fly   517 ------------LNIRDKVCEVCQKAFTN------ANALVKHRHIHKEKTLQCSLCTTRFSERVS 563

  Fly   508 YNHHM-ETHRRDKKATSA 524
            ...|| .||:..|.:.|:
  Fly   564 LGVHMRRTHKILKSSLSS 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 9/66 (14%)
C2H2 Zn finger 268..289 CDD:275371 6/20 (30%)
C2H2 Zn finger 297..318 CDD:275371 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 4/23 (17%)
zf-H2C2_2 373..399 CDD:290200 10/27 (37%)
zf-C2H2_8 375..443 CDD:292531 21/71 (30%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..437 CDD:275368 5/19 (26%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 9/38 (24%)
GT1 276..>341 CDD:304916 10/67 (15%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 3/19 (16%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 5/19 (26%)
C2H2 Zn finger 524..544 CDD:275368 3/25 (12%)
C2H2 Zn finger 551..572 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.