DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and CG11695

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:517 Identity:96/517 - (18%)
Similarity:173/517 - (33%) Gaps:135/517 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 CYICDDRCEPQTSLTDMCTTHTSTKFPNKLAQLVGEGFLVIVCGEDYV----CSRCTNLVNYYDR 143
            |.:|.|..|....:.|. ........|:.||:|:.:...:::...|.|    |::|...:..:::
  Fly     3 CRLCLDDAEHSVPIFDQ-DDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFEQ 66

  Fly   144 LENDVERVKTNLISLLNKKYAINEDMGQEG----------SPPL----KMQKMVGGSANRSLEES 194
            ....|.:.:..|..|..:.::.:||...:.          ||..    :..::.|.:::.|...|
  Fly    67 FCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEECNEIDGDASSNSRSSS 131

  Fly   195 PSADLLRPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKA-TKIYKCTS-----------CDYK 247
            .....||..:|  .:|:.:....|...  :...||.|:.|| ||.:|..:           .:.:
  Fly   132 IRTTSLREMRL--PSPIRRRMRLPRAV--TAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPESR 192

  Fly   248 TSDMRLFNTHYETCKQQTFQCKTC--RKIFPHFGAMKQHMVRDHNTAMDNTCAMCHINFVNE--- 307
            :|:.|..:::  .......:|..|  .:.||:|..||:|....|.:.....|  |...:...   
  Fly   193 SSNSREMDSY--IALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVC--CQRRYKKRALY 253

  Fly   308 -NSLRKHMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFKSTDKV 371
             :.|..|.:.|:                                       :.|..|..:...::
  Fly   254 VDHLHMHNDPNY---------------------------------------FRCKICSKQLVSRI 279

  Fly   372 VFDEHM-RKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQ-----------TNF---------- 414
            .:|.|| |.|.......|.|..||:||..:...|:|::.||           .:|          
  Fly   280 SYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHM 344

  Fly   415 ----------FKCGTCSMTF-PKREMLVKHFEVH----QSPSASTVSPKQSVSQNLNTQKLLQET 464
                      |.|.:|...| .|:.:||....||    |.|.......:..:|...:.:|.:...
  Fly   345 RRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMH 409

  Fly   465 IDEALSDSL-----------PASTAAVVATTESENNIRFFSCSICSLTFIQETYYNHHMETH 515
            :|.|   ||           ..|.|.:.|.....:...:..|:.|:..|........|..||
  Fly   410 LDAA---SLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATH 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 2/32 (6%)
C2H2 Zn finger 268..289 CDD:275371 8/22 (36%)
C2H2 Zn finger 297..318 CDD:275371 4/24 (17%)
C2H2 Zn finger 360..380 CDD:275368 6/20 (30%)
zf-H2C2_2 373..399 CDD:290200 11/26 (42%)
zf-C2H2_8 375..443 CDD:292531 26/104 (25%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..437 CDD:275368 6/20 (30%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 15/78 (19%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 1/20 (5%)
C2H2 Zn finger 357..376 CDD:275368 6/18 (33%)
C2H2 Zn finger 389..409 CDD:275368 2/19 (11%)
C2H2 Zn finger 420..440 CDD:275368 3/19 (16%)
C2H2 Zn finger 448..468 CDD:275368 4/19 (21%)
C2H2 Zn finger 476..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.