DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and CG2129

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:416 Identity:84/416 - (20%)
Similarity:133/416 - (31%) Gaps:113/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ENDVERVKTNLI------SL----LNKKYAINEDMGQEGSPPLKMQKMVGGSANRSLEESPSADL 199
            |::.||...::|      ||    |.:..|:..|..:|.|.    |:..|...:...|...||.:
  Fly   119 EDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSE----QEECGMELDLDSEGRHSAKI 179

  Fly   200 ----------LRPRKLLQGNPVGQSK--IAPGTTQSSVQ---GTQTVQRKATKIYKCTSCDYKTS 249
                      .:.||:|:.:.:.|.|  ::|........   ......:.|.:.|||..|.    
  Fly   180 PHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHCG---- 240

  Fly   250 DMRLFNTHY-------------ETCKQQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDNTCAMCH 301
              ::::..|             |......|.|..|....|....:.:|||:.|..|   .|.:|.
  Fly   241 --KIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGA---ACVVCG 300

  Fly   302 INFVNENSLRKHMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSL--YTCNHCQ 364
            ..:...:.|::| :..|      ||...:|.................|...|.|..  :.|..|.
  Fly   301 RRYKTRHELKRH-QLKH------TSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCG 358

  Fly   365 FKSTDKVVFDEHMRKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNF-FKCGTCSMTFPKRE 428
            :...:|.....|:|.|..  .:||.|::|.:||.:......|...|.|.. ..|..|..||.:::
  Fly   359 YSCRNKETLRVHIRSHTG--ERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQK 421

  Fly   429 MLVKHFEVHQSPSASTVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNIRFF 493
            .|..|..:|    |.|   ||                                           |
  Fly   422 GLYHHKFLH----ADT---KQ-------------------------------------------F 436

  Fly   494 SCSICSLTFIQETYYNHHMETHRRDK 519
            .|.:|...:.|......||..||.|:
  Fly   437 VCKLCGNAYAQAAGLAGHMRKHRNDE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 4/34 (12%)
C2H2 Zn finger 268..289 CDD:275371 6/20 (30%)
C2H2 Zn finger 297..318 CDD:275371 4/20 (20%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
zf-H2C2_2 373..399 CDD:290200 9/25 (36%)
zf-C2H2_8 375..443 CDD:292531 19/68 (28%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..437 CDD:275368 6/19 (32%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 4/20 (20%)
zf-C2H2_8 323..411 CDD:292531 19/89 (21%)
C2H2 Zn finger 327..346 CDD:275368 1/18 (6%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 367..389 CDD:290200 7/23 (30%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
zf-H2C2_2 395..419 CDD:290200 7/23 (30%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.