DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pzg and ZNF513

DIOPT Version :9

Sequence 1:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_653232.3 Gene:ZNF513 / 130557 HGNCID:26498 Length:541 Species:Homo sapiens


Alignment Length:169 Identity:40/169 - (23%)
Similarity:63/169 - (37%) Gaps:34/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 CAMCHINFVNENSLRKHMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENL-------VG 354
            |::|.......|.|.:||:|:              :...|...|....|:|..:||       .|
Human   362 CSLCPFATHYPNHLARHMKTH--------------SGEKPFRCARCPYASAHLDNLKRHQRVHTG 412

  Fly   355 TSLYTCNHCQFKSTDKVVFDEHMRKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNF----- 414
            ...|.|..|.:...:......|.|.|:.  .|||:|.||:....    .:::.|:|....     
Human   413 EKPYKCPLCPYACGNLANLKRHGRIHSG--DKPFRCSLCNYSCN----QSMNLKRHMLRHTGEKP 471

  Fly   415 FKCGTCSMTFPKREMLVKHFEVHQSPSASTVSPKQSVSQ 453
            |:|.||:.|....:...:|.:||....|.  .|..|.|:
Human   472 FRCATCAYTTGHWDNYKRHQKVHGHGGAG--GPGLSASE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371
C2H2 Zn finger 268..289 CDD:275371
C2H2 Zn finger 297..318 CDD:275371 7/20 (35%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
zf-H2C2_2 373..399 CDD:290200 9/25 (36%)
zf-C2H2_8 375..443 CDD:292531 19/72 (26%)
C2H2 Zn finger 390..410 CDD:275368 4/19 (21%)
C2H2 Zn finger 417..437 CDD:275368 5/19 (26%)
ZNF513NP_653232.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
C2H2 Zn finger 152..172 CDD:275368
COG5048 176..>228 CDD:227381
C2H2 Zn finger 180..200 CDD:275368
zf-H2C2_2 192..217 CDD:316026
C2H2 Zn finger 208..228 CDD:275368
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
COG5048 <372..>450 CDD:227381 23/93 (25%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
COG5048 414..>487 CDD:227381 19/78 (24%)
C2H2 Zn finger 418..438 CDD:275368 4/19 (21%)
C2H2 Zn finger 446..466 CDD:275368 5/23 (22%)
C2H2 Zn finger 474..493 CDD:275368 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..541 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.