DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and GCV3

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_009355.3 Gene:GCV3 / 851254 SGDID:S000000042 Length:170 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:54/121 - (44%)
Similarity:77/121 - (63%) Gaps:3/121 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RYTNKHEWVEVVSGSNAIVGISSYAQEALGDVVFAQLPEPGTELKQDDECGALESVKAASEVYSP 106
            |||::|||:.|.....|.|||:.||.:||||..:.:|||.|||:.|.:..|::||||:|||:|.|
Yeast    46 RYTSQHEWIAVHQDKTAFVGITKYATDALGDATYVELPEVGTEIAQGESLGSIESVKSASEIYQP 110

  Fly   107 VSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDL---KNPKELEALMTEDQYKAFL 159
            ..|.|.|.|..:|:.|.:||......|||.|:.|   .|.:::|.||:.:||:..|
Yeast   111 ADGTVEEINTNLEENPGVVNEDPMGDGWLVKMKLGEGVNVEQVEGLMSLEQYEKTL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 53/119 (45%)
GCV3NP_009355.3 gcvH 40..169 CDD:200024 54/121 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344846
Domainoid 1 1.000 111 1.000 Domainoid score I1382
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 111 1.000 Inparanoid score I1378
Isobase 1 0.950 - 0.75 Normalized mean entropy S850
OMA 1 1.010 - - QHG60668
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - oto100239
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - LDO PTHR11715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R481
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.