DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and GDCH

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_181080.1 Gene:GDCH / 818104 AraportID:AT2G35370 Length:165 Species:Arabidopsis thaliana


Alignment Length:148 Identity:62/148 - (41%)
Similarity:92/148 - (62%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ARAIHLTSLLAKER-----------------RYTNKHEWVEVVSGSNAIVGISSYAQEALGDVVF 75
            |.|:.|:|.::|..                 :|.|.||||: ..||.|.:||:::||:.||:|||
plant    11 ANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVK-HEGSVATIGITAHAQDHLGEVVF 74

  Fly    76 AQLPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDL 140
            .:|||..|.:.::...||:|||||.||:.||:||::||.|.::.::|.|:|||.||.||:.||..
plant    75 VELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTESPGLINSSPYEDGWMIKVKP 139

  Fly   141 KNPKELEALMTEDQYKAF 158
            .:|.|||:||...:|..|
plant   140 SSPAELESLMGPKEYTKF 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 58/137 (42%)
GDCHNP_181080.1 PRK01202 35..160 CDD:234918 57/124 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 123 1.000 Domainoid score I1829
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I1911
OMA 1 1.010 - - QHG60668
OrthoDB 1 1.010 - - D1348095at2759
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - otm3195
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - O PTHR11715
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.