DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and AT2G35120

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_181057.1 Gene:AT2G35120 / 818078 AraportID:AT2G35120 Length:156 Species:Arabidopsis thaliana


Alignment Length:142 Identity:63/142 - (44%)
Similarity:93/142 - (65%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QLSVTPLGAVQARAIHLTSLLAKERRYTNKHEWVEVVSGSNAIVGISSYAQEALGDVVFAQLPEP 81
            ::||...|        .:|::.|:.:|.:.||||: :.|:.|..||:.:||:.|||||:.:||:.
plant    16 RISVAQRG--------FSSVVLKDLKYADSHEWVK-IDGNKATFGITDHAQDHLGDVVYVELPDV 71

  Fly    82 GTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDLKNPKEL 146
            |..:.|....||:|||||.|::.|||||||:|.|.|:.::|.|||||.||:||:.||:|.:..|.
plant    72 GHSVSQGKSFGAVESVKATSDINSPVSGKVVEVNEELTESPGLVNSSPYEQGWIIKVELSDAGEA 136

  Fly   147 EALMTEDQYKAF 158
            |.||..|:|..|
plant   137 EKLMDSDKYSKF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 59/120 (49%)
AT2G35120NP_181057.1 PRK01202 25..151 CDD:234918 60/125 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 123 1.000 Domainoid score I1829
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 127 1.000 Inparanoid score I1911
OMA 1 1.010 - - QHG60668
OrthoDB 1 1.010 - - D1348095at2759
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - otm3195
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - LDO PTHR11715
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.