DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and Gcsh

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_080848.1 Gene:Gcsh / 68133 MGIID:1915383 Length:170 Species:Mus musculus


Alignment Length:168 Identity:78/168 - (46%)
Similarity:105/168 - (62%) Gaps:17/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGLQAARQLSV------TPL----------GAVQARAIHLTSLLAKERRYTNKHEWVEVVSGSNA 58
            :.||.:|.|.|      |.|          .|...|::...|.|...|::|.||||:....|...
Mouse     1 MSLQVSRSLRVVAYSLRTALTFCSPRPCVPSAAAVRSLRTGSALLSVRKFTEKHEWITTEEGIGT 65

  Fly    59 IVGISSYAQEALGDVVFAQLPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPA 123
             ||||::|||||||||:..|||.||:||:.:|.|||||||||||:|||:||:|.|.|..:.:.|.
Mouse    66 -VGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPG 129

  Fly   124 LVNSSCYEKGWLFKVDLKNPKELEALMTEDQYKAFLSS 161
            |||.||||.|||.|:.|.:|.|::.||:|:.|:.::.|
Mouse   130 LVNKSCYEDGWLIKMTLSDPSEMDELMSEEAYEKYVKS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 66/119 (55%)
GcshNP_080848.1 PRK01202 48..167 CDD:234918 66/119 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842681
Domainoid 1 1.000 141 1.000 Domainoid score I4709
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 147 1.000 Inparanoid score I4391
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60668
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - oto95031
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - LDO PTHR11715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R481
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.