DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and gcsha

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001013475.1 Gene:gcsha / 541329 ZFINID:ZDB-GENE-050320-18 Length:174 Species:Danio rerio


Alignment Length:162 Identity:74/162 - (45%)
Similarity:101/162 - (62%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITKFARIGLQA-ARQLSVTPLGAVQARAIHLTSLLAKERRYTNKHEWVEVVSGSNAIVGISSYAQ 67
            :.:.:.|...| ||.|:.|    ...|::...:......::|:|||||. |.|..|.||||::||
Zfish    18 LPRLSNINAHAPARLLART----CYRRSLSTNTPFCAALKFTDKHEWVR-VDGGVATVGISNFAQ 77

  Fly    68 EALGDVVFAQLPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSCYEK 132
            |||||||:..|||.|.:|.|.|..|||||||||||:|||::|:|.:.|..:.|.|.|||.|||..
Zfish    78 EALGDVVYCGLPEIGAKLSQTDGFGALESVKAASELYSPLTGEVTDANDALADNPGLVNKSCYND 142

  Fly   133 GWLFKVDLKNPKELEALMTEDQYKAFLSSSGD 164
            |||.|:.:..|:||:.||.|..|:.::.|..|
Zfish   143 GWLMKMTVSIPEELDGLMDEAAYERYIKSIED 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 65/119 (55%)
gcshaNP_001013475.1 PRK01202 52..171 CDD:234918 65/119 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4793
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 143 1.000 Inparanoid score I4439
OMA 1 1.010 - - QHG60668
OrthoDB 1 1.010 - - D1348095at2759
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - otm25409
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - LDO PTHR11715
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.