DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and gcshb

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001002579.1 Gene:gcshb / 436852 ZFINID:ZDB-GENE-040718-319 Length:174 Species:Danio rerio


Alignment Length:133 Identity:72/133 - (54%)
Similarity:96/133 - (72%) Gaps:1/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RAIHLTSLLAKERRYTNKHEWVEVVSGSNAIVGISSYAQEALGDVVFAQLPEPGTELKQDDECGA 93
            |.:..:|.|:...::|:|||||. |.||...||||::|||||||||:..|||.||:|.|.:|.||
Zfish    40 RTLSTSSRLSGALKFTDKHEWVR-VEGSVGTVGISNFAQEALGDVVYCGLPEVGTKLDQMEEFGA 103

  Fly    94 LESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDLKNPKELEALMTEDQYKAF 158
            |||||||||:|||::|:|...|.|:.:.|||||.:|||.|||.|:.::.|.||:.||.|..|:.|
Zfish   104 LESVKAASELYSPLTGEVTAINTELTENPALVNKACYEGGWLIKMTIEKPAELDELMDEAAYEKF 168

  Fly   159 LSS 161
            :.|
Zfish   169 IKS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 67/119 (56%)
gcshbNP_001002579.1 PRK01202 52..171 CDD:234918 68/119 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4793
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 143 1.000 Inparanoid score I4439
OMA 1 1.010 - - QHG60668
OrthoDB 1 1.010 - - D1348095at2759
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - otm25409
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - O PTHR11715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R481
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1414.010

Return to query results.
Submit another query.