DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and gcv3

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_596169.1 Gene:gcv3 / 2541294 PomBaseID:SPBP19A11.01 Length:169 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:58/118 - (49%)
Similarity:81/118 - (68%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RRYTNKHEWVEVVSGSNAIVGISSYAQEALGDVVFAQLPEPGTELKQDDECGALESVKAASEVYS 105
            :.:|.:||||: |.|....|||:|||..|||:|||.:||||.|.:...|..||:||||:||:|||
pombe    45 KHFTKEHEWVK-VDGDVGTVGITSYAANALGEVVFVELPEPETTVSVGDGIGAVESVKSASDVYS 108

  Fly   106 PVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDLKNPKELEALMTEDQYKAF 158
            ||||.|...|..:.|:|..|:||..|:||:.|:.|.:|.||::|:.::.|..|
pombe   109 PVSGTVTSINESLGDSPDKVSSSPEEEGWICKIKLSSPDELKSLLNDESYAQF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 58/118 (49%)
gcv3NP_596169.1 PRK01202 46..164 CDD:234918 58/117 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1516
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 117 1.000 Inparanoid score I1527
OMA 1 1.010 - - QHG60668
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - oto101994
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - LDO PTHR11715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R481
SonicParanoid 1 1.000 - - X1323
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.