DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and gcsh-1

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_510414.1 Gene:gcsh-1 / 183902 WormBaseID:WBGene00008354 Length:148 Species:Caenorhabditis elegans


Alignment Length:161 Identity:72/161 - (44%)
Similarity:104/161 - (64%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFITKFARIGLQAARQLSVTPLGAVQAR-AIHLTSLLAKERRYTNKHEWVEVVSGSNAIVGISS 64
            |.|:::|               :..|.|| ||...|   ..|.||.||||: ||:.|...|||:.
 Worm     1 MSFLSRF---------------IPTVTARTAIRFAS---NGRLYTKKHEWI-VVNQSVGTVGITD 46

  Fly    65 YAQEALGDVVFAQLPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSC 129
            :|.|.||||||.:|||.|.|:::.|..||:|||||||::|:|||||::|||.::||.|.::|.|.
 Worm    47 FATEQLGDVVFIELPEAGVEIEKGDSTGAVESVKAASDIYAPVSGKILEKNTKLEDEPGIINKSP 111

  Fly   130 YEKGWLFKVDLKNPKELEALMTEDQYKAFLS 160
            .|||||:::::.:.::|..|:||:||..|.|
 Worm   112 LEKGWLYRLEITSNEQLNELLTEEQYNKFKS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 61/119 (51%)
gcsh-1NP_510414.1 GCV_H 24..144 CDD:279878 63/120 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161275
Domainoid 1 1.000 136 1.000 Domainoid score I3055
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 138 1.000 Inparanoid score I3094
Isobase 1 0.950 - 0.75 Normalized mean entropy S850
OMA 1 1.010 - - QHG60668
OrthoDB 1 1.010 - - D1348095at2759
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - otm14235
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - O PTHR11715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R481
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.