DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppl and Gcsh

DIOPT Version :9

Sequence 1:NP_524197.1 Gene:ppl / 40349 FlyBaseID:FBgn0027945 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_598282.2 Gene:Gcsh / 171133 RGDID:619946 Length:170 Species:Rattus norvegicus


Alignment Length:153 Identity:77/153 - (50%)
Similarity:101/153 - (66%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RIGLQAARQLSVTPLGAVQARAIHLTSLLAKERRYTNKHEWVEVVSGSNAIVGISSYAQEALGDV 73
            ||.|.:.......| .|...|::...|.|...|::|.|||||....|... ||||::||||||||
  Rat    17 RIALASCPPRPWAP-SAAAVRSLRTGSALLSVRKFTEKHEWVTAKDGIGT-VGISNFAQEALGDV 79

  Fly    74 VFAQLPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKV 138
            |:..|||.||:||:.:|.|||||||||||:|||:||:|.|.|..:.:.|.|||.||||.|||.|:
  Rat    80 VYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKM 144

  Fly   139 DLKNPKELEALMTEDQYKAFLSS 161
            .|.:|.||:.||:|:.|:.::.|
  Rat   145 TLSDPSELDELMSEEAYEKYVKS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pplNP_524197.1 PRK01202 39..159 CDD:234918 68/119 (57%)
GcshNP_598282.2 PRK01202 48..167 CDD:234918 68/119 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346146
Domainoid 1 1.000 142 1.000 Domainoid score I4565
eggNOG 1 0.900 - - E1_COG0509
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90880
Inparanoid 1 1.050 148 1.000 Inparanoid score I4306
OMA 1 1.010 - - QHG60668
OrthoDB 1 1.010 - - D1348095at2759
OrthoFinder 1 1.000 - - FOG0001795
OrthoInspector 1 1.000 - - otm46278
orthoMCL 1 0.900 - - OOG6_100619
Panther 1 1.100 - - LDO PTHR11715
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1323
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.