DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and Impa1

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_006232213.1 Gene:Impa1 / 83523 RGDID:69254 Length:330 Species:Rattus norvegicus


Alignment Length:275 Identity:107/275 - (38%)
Similarity:162/275 - (58%) Gaps:8/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPNHQFIA 340
            :|...:||    ::||.:.....|...:...|....|:||.||..||:..:.:|..:||.|.||.
  Rat    62 MDYAVILA----RQAGEMIREALKNKMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPYHSFIG 122

  Fly   341 EERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIYNPPMKNMYT 405
            ||.::..|  ....|:.|||||||||||.||||.||:..:|:.::||:|.:||::|:.....|||
  Rat   123 EESVAAGE--KTVFTEQPTWIIDPIDGTTNFVHRFPFVAVSIGFVVNKEMEFGVVYSCVEDKMYT 185

  Fly   406 AQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLVK-KTHAMRSIGSSA 469
            .:.||||..||:.:|.:.|.:::.::::.|..|.......::...|.:||.. ..|.:||:|::|
  Rat   186 GRKGKGAFCNGQKLRVSQQEDITKSLLVTELGSSRKPETLRIVLSNMERLCSIPIHGIRSVGTAA 250

  Fly   470 MCLAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCLAASTDYLALEL 534
            :.:.:||:|.|||:|..|:|.||||...:||.|||||::|..|...|:||||.:|||...||..:
  Rat   251 VNMCLVATGGADAYYEMGIHCWDMAGAGIIVIEAGGVLLDVTGGPFDLMSRRIIAASNIALAERI 315

  Fly   535 GNCLQQNYPSPRDDE 549
            ...| :..|..||||
  Rat   316 AKEL-EIIPLQRDDE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 96/247 (39%)
Impa1XP_006232213.1 IMPase 61..307 CDD:238817 97/250 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm9083
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.