DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and VTC4

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_186936.1 Gene:VTC4 / 821206 AraportID:AT3G02870 Length:271 Species:Arabidopsis thaliana


Alignment Length:263 Identity:104/263 - (39%)
Similarity:151/263 - (57%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 DQFSASDLDTLFLLACREVKKAGAIALAENKKNQEYTTK----KHTNDIVTPTDNIVEESFIKAI 329
            |||.|:.:|.        .||||.|.     :...|.||    |...|:||.||...||.....:
plant     8 DQFLAAAIDA--------AKKAGQII-----RKGFYETKHVEHKGQVDLVTETDKGCEELVFNHL 59

  Fly   330 SSRYPNHQFIAEERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGI 394
            ...:|||:||.||  :.:..|:..|||:||||:||:|||.||||.||:.|:|:...:.:....|:
plant    60 KQLFPNHKFIGEE--TTAAFGVTELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPVVGV 122

  Fly   395 IYNPPMKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLVKKT 459
            :|||.|:.::|...||||.:||:.|:.:.|:.|..|:::.|..:..::|.....|.....|:.|.
plant   123 VYNPIMEELFTGVQGKGAFLNGKRIKVSAQSELLTALLVTEAGTKRDKATLDDTTNRINSLLTKV 187

  Fly   460 HAMRSIGSSAMCLAMVASGVADAFYNFGL-HVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCL 523
            .::|..||.|:.|..||.|..|.||..|. ..||:|||.:||.||||::.||:|::|||.|:| :
plant   188 RSLRMSGSCALDLCGVACGRVDIFYELGFGGPWDIAAGIVIVKEAGGLIFDPSGKDLDITSQR-I 251

  Fly   524 AAS 526
            |||
plant   252 AAS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 97/251 (39%)
VTC4NP_186936.1 PLN02553 1..269 CDD:178168 104/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 223 1.000 Domainoid score I700
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D915621at2759
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - otm2417
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.