DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and impa2

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001018408.1 Gene:impa2 / 553595 ZFINID:ZDB-GENE-050522-349 Length:275 Species:Danio rerio


Alignment Length:273 Identity:112/273 - (41%)
Similarity:162/273 - (59%) Gaps:13/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 CREV-----KKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPNHQFIAEER 343
            |.:|     ::||.:.....:..:..::|....|:||..|:.|||..|..:..:||.|:||.|| 
Zfish     7 CLDVAVDIARRAGQMVSCAVQLEKRVSSKSTPTDLVTEADHQVEELIISTLREKYPTHRFIGEE- 70

  Fly   344 ISKSETGM-VTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIYNPPMKNMYTAQ 407
              .|..|: ..|||.|||||||||||.||||.||...:|:.:.|.:|.:||:||:.....:|||:
Zfish    71 --SSAAGVKCELTDSPTWIIDPIDGTCNFVHSFPMVAVSIGFAVRKELEFGVIYHCFDGTLYTAR 133

  Fly   408 LGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLVK-KTHAMRSIGSSAMC 471
            .|.||..||..::.:.:.::|.|::|.|..:..:.|...:...|.::::. .||.:|.||||.:.
Zfish   134 KGHGAFCNGVRLQVSKEKDVSKALILTEIGAKRDSATLDIFLGNMKKILSAPTHGVRIIGSSTLS 198

  Fly   472 LAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCLAASTDYLALELGN 536
            |..||||.|:|:|.:|||.||:||.|:|:.||||.|||..|..||:||||.:||.|..:|..:..
Zfish   199 LCQVASGAAEAYYQYGLHCWDIAAAAVIIREAGGCVMDTTGGPLDLMSRRVVAAGTREIAEYVVK 263

  Fly   537 CLQQ-NYPSPRDD 548
            .||. ||  .|||
Zfish   264 QLQPINY--GRDD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 102/248 (41%)
impa2NP_001018408.1 IMPase 7..252 CDD:238817 101/247 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22799
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm6554
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.