DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and impa1

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001017057.1 Gene:impa1 / 549811 XenbaseID:XB-GENE-1004318 Length:280 Species:Xenopus tropicalis


Alignment Length:283 Identity:116/283 - (40%)
Similarity:177/283 - (62%) Gaps:9/283 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 LPDQFSASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISS 331
            :.||:..| :|...|:|    :|||::..|..|::.....|....|:||.||..|||..|.:|..
 Frog     1 MEDQWQES-MDFAILIA----RKAGSVVCAALKEDVSIMVKSSPADLVTATDQKVEEMLISSIKE 60

  Fly   332 RYPNHQFIAEERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIY 396
            :||:|.||.||.::.....  ||||:|||||||||||.||||.||:..:|:.:.||::.:||::|
 Frog    61 KYPSHSFIGEESVAAGAGS--TLTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKQVEFGVVY 123

  Fly   397 NPPMKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLV-KKTH 460
            :.....|||.:.||||..||:.::.:||.:::.:|::.|..|..|....::...|.:||: ...|
 Frog   124 SCVEDKMYTGRKGKGAFCNGQKLQVSGQKDITKSMIITELGSNRNPEVIKMVLSNMERLLCIPIH 188

  Fly   461 AMRSIGSSAMCLAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCLAA 525
            .:|::|::|:.:.:||:|.|||:|..|:|.|||||.::|:|||||||:|..|...|:||.|.:||
 Frog   189 GIRAVGTAAVNMCLVATGGADAYYEMGIHCWDMAAASVIITEAGGVVLDATGGAFDLMSCRVIAA 253

  Fly   526 STDYLALELGNCLQQNYPSPRDD 548
            |:..:|..:...| |..|..|||
 Frog   254 SSRDIAERIAKEL-QIIPLERDD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 103/247 (42%)
impa1NP_001017057.1 IMPase 9..254 CDD:238817 104/250 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm9498
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.