DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and BPNT2

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_060283.3 Gene:BPNT2 / 54928 HGNCID:26019 Length:359 Species:Homo sapiens


Alignment Length:272 Identity:55/272 - (20%)
Similarity:98/272 - (36%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 REVKKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPNHQFIAEERISKSET 349
            |.|:::.  .|.|..|.:   |::...|.:|..|.:........:.:.:|:.|...||.:..::.
Human    82 RRVRESN--VLHEKSKGK---TREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAADQ 141

  Fly   350 GMV----TLTDD----------------PTWIIDPIDGTMNFVHHF-PYYCISVAYLVNQETQFG 393
            .::    .:.:|                ..| |||:|.|..:.... .|....|...||.:...|
Human   142 EVILWDHKIPEDILKEVTTPKEVPAESVTVW-IDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLG 205

  Fly   394 IIYNPPMKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLVKK 458
            :|:.|  .:.|||           .....|.:|:.|       .|..||...::....|...:.|
Human   206 VIHKP--FSEYTA-----------WAMVDGGSNVKA-------RSSYNEKTPRIVVSRSHSGMVK 250

  Fly   459 THAMRSIGSSAMCLAMVASGV---------------ADAFYNFGLHV-----WDMAAGALIVTEA 503
            ..|:::.|:....:....:|.               ||.:    :||     ||:.||..|:...
Human   251 QVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLY----IHVTYIKKWDICAGNAILKAL 311

  Fly   504 GGVVMDPAGEEL 515
            ||.:...:|||:
Human   312 GGHMTTLSGEEI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 55/272 (20%)
BPNT2NP_060283.3 IPPase 66..349 CDD:238818 55/272 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.