DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and impa1

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001002745.1 Gene:impa1 / 437018 ZFINID:ZDB-GENE-040718-245 Length:282 Species:Danio rerio


Alignment Length:295 Identity:112/295 - (37%)
Similarity:175/295 - (59%) Gaps:21/295 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 LPDQFSASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISS 331
            :||.:..: :|....||    :|||.|.....:.:.:...|..:.|:||.||..||:..|.::..
Zfish     1 MPDLWQDA-MDHAVTLA----RKAGEIVREALQNDLKIMCKSSSVDLVTKTDQNVEQLIITSVKE 60

  Fly   332 RYPNHQFIAEERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIY 396
            ::|.|.||.||.::..|.  ..||::||||:||:|||.||||.:|:..:|:.:.||:..:||::|
Zfish    61 KFPEHSFIGEESVAAGEP--CVLTENPTWIVDPVDGTTNFVHGYPFVAVSIGFAVNKTLEFGVVY 123

  Fly   397 NPPMKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSN-EARNQVATENSQR--LVKK 458
            :.....||||:.||||..||:.::.:.|..::.:::..|:  ||| :..|.....:|.|  |...
Zfish   124 SCIEDKMYTARKGKGAFCNGQPLQVSDQKEINQSIIATEF--GSNRDPENVEKIFSSMRKILCLP 186

  Fly   459 THAMRSIGSSAMCLAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCL 523
            .|.:|..||:|:.:.:||:|..:|:|..|:|.|||||||:||:|||||::|..|...|:||||.|
Zfish   187 VHGIRGAGSAAINMCLVAAGCVEAYYEIGIHCWDMAAGAVIVSEAGGVLLDVEGGPFDLMSRRVL 251

  Fly   524 AASTDYLALELGNCLQQN---YPSPRDDEPRSVNP 555
            ||:..    .:|..:.|.   :|:.|||.|  |||
Zfish   252 AANNK----TIGERIVQEVEAFPAVRDDAP--VNP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 98/249 (39%)
impa1NP_001002745.1 IMPase 9..254 CDD:238817 99/252 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm6554
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.