DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and CG7789

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster


Alignment Length:311 Identity:69/311 - (22%)
Similarity:109/311 - (35%) Gaps:83/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 ASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPNHQ 337
            ||.:.|        .|:||.|.....||.......|..||..|..|...:...|.:::.::|..:
  Fly    13 ASSIST--------AKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVK 69

  Fly   338 FIAEERISKSETGMVTLTDDPTWI----------------------------IDPIDGTMNFVH- 373
            .|.||..|.     :.:.||  |:                            :||:|||..:.. 
  Fly    70 IIGEEGGSD-----LNVCDD--WLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQG 127

  Fly   374 HFPYYCISVAYLVNQETQFGIIYNPPMKNMYTAQLGKGAQMNGEMIRTT---------GQTNLSA 429
            |..:..:.:...|......|||:.|    .|       .|.:|||.||.         |.|.:.|
  Fly   128 HVEHVTVLIGIAVKDAAVGGIIHQP----FY-------QQPDGEMGRTIWGLKGLGTGGFTAVPA 181

  Fly   430 ---AMVLQEYSSGSNEARNQVATENSQRLVKKTHAMRSIGSSAMCLAMVASGVADA--FYNFGLH 489
               ..::....|.||....|.....:...|.|      :|.:...:..:..|.|.|  |...|..
  Fly   182 PAGQFIITTTRSHSNALHQQALNAFASTEVLK------VGGAGFKVLQLLEGKAHAYVFATPGCK 240

  Fly   490 VWDMAAGALIVTEAGGVVMDPAGE------ELDIMSRRCLAAS--TDYLAL 532
            .||..|...::...||.:.:..||      :::.::|:.:.||  .|:.||
  Fly   241 KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAAL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 61/295 (21%)
CG7789NP_651728.1 IPPase 12..294 CDD:238818 69/311 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.