DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and CG17027

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster


Alignment Length:286 Identity:101/286 - (35%)
Similarity:156/286 - (54%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 SASDLDTLFLLACREVKKAGAIAL-AENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPN 335
            |.:|::.|:........|||.|.: .....::..:.|....|:||..||.:|:..::.|.:|||:
  Fly     5 SQADIEELYNFIHPLAIKAGEILMEGYEMASKNVSIKGDFYDVVTDYDNKIEDFLMEKILARYPD 69

  Fly   336 HQFIAEERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIYNPPM 400
            |:||.||..:|:......||:.|||||||||||.||:...|:.|:|:...:|::...|:|.||..
  Fly    70 HKFIGEEETAKNNNVSGELTNAPTWIIDPIDGTSNFIKQIPHVCVSIGLAINKQIVVGVINNPVQ 134

  Fly   401 KNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLVK-KTHAMRS 464
            |.::|.:||:||..||:.|..:...::..|.|..|.|.   ...:.||.::.:|:.. ..:|.|.
  Fly   135 KKLFTTKLGQGAFCNGKPIHVSSCESVKDANVAYEVSL---LHVHSVANKHIKRIYHVGLNARRL 196

  Fly   465 IGSSAMC--LAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCLAAST 527
            :..|.:.  |.|||:|..||||...::.||.|||:|:|.||||||..|.|...|||....:.|.|
  Fly   197 VAYSCVVDELCMVAAGNLDAFYIEDMYPWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAGT 261

  Fly   528 DYLALELGNCLQQNYPSPRDDEPRSV 553
            :.|..|:.:.|:      :.|:..||
  Fly   262 EKLRKEIEDLLR------KGDQEESV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 91/250 (36%)
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 91/249 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445181
Domainoid 1 1.000 149 1.000 Domainoid score I193
eggNOG 1 0.900 - - E1_COG0483
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1410
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107379at33392
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - otm51346
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - P PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.