DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and CG17028

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster


Alignment Length:264 Identity:89/264 - (33%)
Similarity:139/264 - (52%) Gaps:16/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LDTLFLLACREVKKAGAIAL-AENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPNHQFI 339
            |:..:.::...|:|.|.:.| ...|...:|..|....|:||..|..:|.:....:...:|..:.|
  Fly    10 LEVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKII 74

  Fly   340 AEERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIYNPPMKNMY 404
            .||.::.::| ...|||.|||||||||||.|:|...|:.||||...:|:|...||:|||....:|
  Fly    75 GEEAMANAKT-PPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELY 138

  Fly   405 TAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGSNEARNQVATENSQRLVKKTHAM------- 462
            :|..|.||.:||:.|..:....::.|:|..|.|.       .|.::...:.||:.:.:       
  Fly   139 SAWQGHGAYLNGQPIEVSNAKKINQALVCYEISL-------IVVSKGRDKNVKRLYKLASSATGT 196

  Fly   463 RSIGSSAMCLAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRCLAAST 527
            ||.|.:|:.|..:|:|..||::...|..||:|.||:|:.||||.|...:|...|:|...|:..|:
  Fly   197 RSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSS 261

  Fly   528 DYLA 531
            :.||
  Fly   262 EELA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 85/254 (33%)
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 85/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445179
Domainoid 1 1.000 149 1.000 Domainoid score I193
eggNOG 1 0.900 - - E1_COG0483
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107379at33392
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - otm51346
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - P PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.