DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and CG17029

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster


Alignment Length:278 Identity:103/278 - (37%)
Similarity:152/278 - (54%) Gaps:18/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 SASDLDTLFLLACREVKKAGAIALAE--NKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYP 334
            |.|.|...:.:|.:.|.|.|.: :.|  .|...||..|....|:||..|..:|:...:.:.:.:|
  Fly     6 SESKLKEYYDVALKLVLKCGPL-MQEGYQKAKTEYKVKADFYDLVTVYDKQIEDILTEGLVAAFP 69

  Fly   335 NHQFIAEERISKSETGMVTLTDDPTWIIDPIDGTMNFVHHFPYYCISVAYLVNQETQFGIIYNPP 399
            ....|.||..:.|:. ...|||.|||||||||||.||:|..|:.||||...:|:|...|||||||
  Fly    70 ESLIIGEEESAVSQR-QAELTDAPTWIIDPIDGTTNFIHRIPHCCISVGLAINKELVVGIIYNPP 133

  Fly   400 MKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQE----YSSGSNEARNQVATENSQRLVK--- 457
            ...:::|..|.||.:|||.|.|:..|.:..|::..|    :::|       |..:|.:||.|   
  Fly   134 ANELFSAYKGHGAYLNGEPIHTSKVTTIKQAVIAYEISLIHAAG-------VRDKNVKRLYKMAS 191

  Fly   458 KTHAMRSIGSSAMCLAMVASGVADAFYNFGLHVWDMAAGALIVTEAGGVVMDPAGEELDIMSRRC 522
            .....|..||:|:.|..||:|..||::...|..||:||||:|:|||||.|...:|.:.|:|...|
  Fly   192 NATGTRCFGSAALTLCYVATGQCDAYHVEDLKPWDIAAGAIILTEAGGTVCHTSGSKFDVMKPDC 256

  Fly   523 LAASTDYLALELGNCLQQ 540
            :.|:|..||..:.:.:::
  Fly   257 VCAATPELAKNVISLIEE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 96/255 (38%)
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 97/256 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445177
Domainoid 1 1.000 149 1.000 Domainoid score I193
eggNOG 1 0.900 - - E1_COG0483
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1410
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107379at33392
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - otm51346
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - P PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.