DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and IMPA1

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001138350.1 Gene:IMPA1 / 3612 HGNCID:6050 Length:336 Species:Homo sapiens


Alignment Length:307 Identity:116/307 - (37%)
Similarity:180/307 - (58%) Gaps:10/307 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 ATNTSGMLYSDEENEPEEEEFPKLPDQFSASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKK 308
            |.|:|| :|...:.:...:.|.|:.|.:... :|....||    ::||.:.....|.......|.
Human    38 AGNSSG-VYGFGKMKIFVKYFQKMADPWQEC-MDYAVTLA----RQAGEVVCEAIKNEMNVMLKS 96

  Fly   309 HTNDIVTPTDNIVEESFIKAISSRYPNHQFIAEERISKSETGMVTLTDDPTWIIDPIDGTMNFVH 373
            ...|:||.||..||:..|.:|..:||:|.||.||.::..|..:  |||:|||||||||||.||||
Human    97 SPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSI--LTDNPTWIIDPIDGTTNFVH 159

  Fly   374 HFPYYCISVAYLVNQETQFGIIYNPPMKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSS 438
            .||:..:|:.:.||::.:||::|:.....||||:.||||..||:.::.:.|.:::.::::.|..|
Human   160 RFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGS 224

  Fly   439 GSNEARNQVATENSQRL-VKKTHAMRSIGSSAMCLAMVASGVADAFYNFGLHVWDMAAGALIVTE 502
            .......::...|.::| ....|.:||:|::|:.:.:||:|.|||:|..|:|.||:|...:||||
Human   225 SRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTE 289

  Fly   503 AGGVVMDPAGEELDIMSRRCLAASTDYLALELGNCLQQNYPSPRDDE 549
            ||||:||..|...|:||||.:||:...||..:...:|. .|..||||
Human   290 AGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQV-IPLQRDDE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 98/247 (40%)
IMPA1NP_001138350.1 IMPase 67..313 CDD:238817 99/252 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1410
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm8602
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.