DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and CG15743

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:287 Identity:59/287 - (20%)
Similarity:107/287 - (37%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 EEEFPKL-----PDQFSASDLDTLFLLACREVKKAG--AIALAENKKNQEYT---TKKHTNDIVT 315
            :||.|.:     .:..|..:|..:.:.|.:..::.|  .:.:|.:::.:|.:   |.:..||..|
  Fly    37 QEERPAIYGMLRSENPSRVNLRKMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFT 101

  Fly   316 PTDNIVEESFIKAISSRYPNHQFIAEERISKS----------------ETGM-----VTLTDDPT 359
            ..|........:.:...:|..|..:||  .|.                ||..     |...|...
  Fly   102 DADGRSHCVMKQGLQRIFPRVQIFSEE--DKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTV 164

  Fly   360 WIIDPIDGTMNFVHHFPYY-----CISVAYLVNQETQFGIIYNPPMKNMYTAQLGKGAQMNGEM- 418
            | :||:|.|..|......|     |::||    .....|:|::|  .|..||....|..|:..: 
  Fly   165 W-VDPLDATKEFTEELYEYVTTMVCVAVA----GRPIIGVIHSP--FNGQTAWAWVGNSMSEYLS 222

  Fly   419 -IRTTGQTNLSAAM--VLQEYSSGSNEARNQVATENSQRLVKKTHAMRSIGSSAMCLAMVASGVA 480
             :......|..|.:  |.:.:::|:.:....:..||...|.       :.|:....|.:||:...
  Fly   223 NLHPQHSPNNQAPIITVSRSHTAGAKDLARGIFGENVSLLT-------AAGAGYKVLQVVANNAT 280

  Fly   481 DAFYNFGLHVWDMAAGALIVTEAGGVV 507
            ...:...:..||:.||..|:...||.:
  Fly   281 AYLHTSKIKKWDICAGDAILHALGGTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 54/264 (20%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 54/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.