DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9389 and Bpnt2

DIOPT Version :9

Sequence 1:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001008772.2 Gene:Bpnt2 / 312952 RGDID:1306455 Length:356 Species:Rattus norvegicus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:108/298 - (36%) Gaps:93/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 DLDTLFLLACREVKKAG--------AIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISS 331
            ||..:..:|....::.|        :..|.|..|.:   |::...|.:|..|.:........:.:
  Rat    60 DLREMLAVAVLAAERGGDEVRRVRESNVLHEKSKGK---TREGAEDKMTSGDVLSNRKMFYLLKT 121

  Fly   332 RYPNHQFIAEERISKSETGMVT----LTDD----------------PTWIIDPIDGTMNFVHHF- 375
            .:||.|...||.:..|:..::.    :.:|                ..| |||:|.|..:.... 
  Rat   122 AFPNVQINTEEHVDASDKEVIVWNRKIPEDILKEIAAPKEVPAESVTVW-IDPLDATQEYTEDLR 185

  Fly   376 PYYCISVAYLVNQETQFGIIYNPPMKNMYTAQLGKGAQMNGEMIRTTGQTNLSAAMVLQEYSSGS 440
            .|....|...||.:...|:|:.|  .:.|||.                      |||    .|||
  Rat   186 KYVTTMVCVAVNGKPVLGVIHKP--FSEYTAW----------------------AMV----DSGS 222

  Fly   441 N-EARNQVATENSQRLVKKTH-------AMRSIGSSAMCLAMVASGV---------------ADA 482
            | :||:....:..:.:|.::|       |:::.|:..:.:....:|.               ||.
  Rat   223 NVKARSSYNEKTPKIIVSRSHAGMVKQVALQTFGNQTLIIPAGGAGYKVLALLDVPDMTQEKADL 287

  Fly   483 FYNFGLHV-----WDMAAGALIVTEAGGVVMDPAGEEL 515
            :    :||     ||:.||..|:...||.:...:|||:
  Rat   288 Y----IHVTYIKKWDICAGNAILKALGGHMTTLSGEEI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9389NP_649295.1 IMPase 279..526 CDD:238817 60/294 (20%)
Bpnt2NP_001008772.2 IPPase 64..347 CDD:238818 60/294 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..104 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.