DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and IMPL1

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_564376.1 Gene:IMPL1 / 840007 AraportID:AT1G31190 Length:371 Species:Arabidopsis thaliana


Alignment Length:276 Identity:94/276 - (34%)
Similarity:142/276 - (51%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VEKCLEVASNLVSEAGRLIARNNEQRQDFVCKSNDI------DLVTQTDKDVEQLLMDGIRRHFP 65
            ||...:..:.:|.||              |.|..:|      ||||.|||..|..:::.::::|.
plant    91 VELAAKTGAEVVMEA--------------VNKPRNITYKGLSDLVTDTDKASEAAILEVVKKNFS 141

  Fly    66 EHKFIGEEESSGAEGVKKLTDEPTWIIDPVDGTMNFVHAFPHSCISVGL------KVNKVTELGL 124
            :|..:|||  .|..|  ..:.:..|.|||:|||.||.|.:|...:|||:      ....|.|  .
plant   142 DHLILGEE--GGIIG--DSSSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLYRGNPAAASVVE--F 200

  Fly   125 VYNPIL--EQRFTARRGHGAFYNGRRIHVSGQKELGKALVTSEFGTTRDEAKMKVVHENFEKMAK 187
            |..|:.  .:.|:|..|.||..||::||||....:.:||:.:.||...|:| .....|.|::...
plant   201 VGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAVERALLITGFGYEHDDA-WSTNMELFKEFTD 264

  Fly   188 KAHGLRVLGSAALNMSMVALGAADANYEFGIHAWDVCAGDLIVREAGGVVIDPAGGEFDIMSRRV 252
            .:.|:|.||:||::|..||||.|::.:|:.:..||:.||.|||.||||.|....||:|.:..|.|
plant   265 VSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPWDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSV 329

  Fly   253 LAA---ATPELAQEIS 265
            |.:   ..|:|.:.|:
plant   330 LVSNGVLHPKLLERIA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 89/258 (34%)
IMPL1NP_564376.1 PLN02737 11..371 CDD:215392 94/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D915621at2759
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.