DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and Impa1

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_006530140.1 Gene:Impa1 / 55980 MGIID:1933158 Length:330 Species:Mus musculus


Alignment Length:273 Identity:124/273 - (45%)
Similarity:184/273 - (67%) Gaps:5/273 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EKCLEVASNLVSEAGRLIARNNEQRQDFVCKSNDIDLVTQTDKDVEQLLMDGIRRHFPEHKFIGE 72
            ::|::.|..|..:||.:|....:...|.:.||:..||||.||:.||::||..|:..:|.|.||||
Mouse    59 QECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGE 123

  Fly    73 EESSGAEGVKKL-TDEPTWIIDPVDGTMNFVHAFPHSCISVGLKVNKVTELGLVYNPILEQRFTA 136
            |  |.|.|.|.: |::|||:|||:|||.||||.||...:|:|..|||..|.|:||:.:.::.:|.
Mouse   124 E--SVAAGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTG 186

  Fly   137 RRGHGAFYNGRRIHVSGQKELGKALVTSEFGTTRDEAKMKVVHENFEKMAK-KAHGLRVLGSAAL 200
            |:|.|||.||:::.||.|:::.|:|:.:|.|::|....:::|..|.||:.. ..||:|.:|:||:
Mouse   187 RKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKLCSIPIHGIRSVGTAAV 251

  Fly   201 NMSMVALGAADANYEFGIHAWDVCAGDLIVREAGGVVIDPAGGEFDIMSRRVLAAATPELAQEIS 265
            ||.:||.|.|||.||.|||.||:....:||.|||||::|..||.||:||||::||.:..||:.|:
Mouse   252 NMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIA 316

  Fly   266 KVLTQFNPLPRDD 278
            |.: :..||.|||
Mouse   317 KEI-EIIPLQRDD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 113/246 (46%)
Impa1XP_006530140.1 IMPase 61..307 CDD:238817 114/247 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I2292
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4043
Inparanoid 1 1.050 244 1.000 Inparanoid score I3276
Isobase 1 0.950 - 0 Normalized mean entropy S1410
OMA 1 1.010 - - QHG54074
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm8836
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - LDO PTHR20854
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2586
SonicParanoid 1 1.000 - - X706
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.