DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and impa1

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001017057.1 Gene:impa1 / 549811 XenbaseID:XB-GENE-1004318 Length:280 Species:Xenopus tropicalis


Alignment Length:272 Identity:122/272 - (44%)
Similarity:183/272 - (67%) Gaps:3/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EKCLEVASNLVSEAGRLIARNNEQRQDFVCKSNDIDLVTQTDKDVEQLLMDGIRRHFPEHKFIGE 72
            ::.::.|..:..:||.::....::....:.||:..||||.||:.||::|:..|:..:|.|.||||
 Frog     6 QESMDFAILIARKAGSVVCAALKEDVSIMVKSSPADLVTATDQKVEEMLISSIKEKYPSHSFIGE 70

  Fly    73 EESSGAEGVKKLTDEPTWIIDPVDGTMNFVHAFPHSCISVGLKVNKVTELGLVYNPILEQRFTAR 137
            |..:...| ..|||.|||||||:|||.||||.||...:|:|..|||..|.|:||:.:.::.:|.|
 Frog    71 ESVAAGAG-STLTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKQVEFGVVYSCVEDKMYTGR 134

  Fly   138 RGHGAFYNGRRIHVSGQKELGKALVTSEFGTTRDEAKMKVVHENFEK-MAKKAHGLRVLGSAALN 201
            :|.|||.||:::.|||||::.|:::.:|.|:.|:...:|:|..|.|: :....||:|.:|:||:|
 Frog   135 KGKGAFCNGQKLQVSGQKDITKSMIITELGSNRNPEVIKMVLSNMERLLCIPIHGIRAVGTAAVN 199

  Fly   202 MSMVALGAADANYEFGIHAWDVCAGDLIVREAGGVVIDPAGGEFDIMSRRVLAAATPELAQEISK 266
            |.:||.|.|||.||.|||.||:.|..:|:.||||||:|..||.||:||.||:||::.::|:.|:|
 Frog   200 MCLVATGGADAYYEMGIHCWDMAAASVIITEAGGVVLDATGGAFDLMSCRVIAASSRDIAERIAK 264

  Fly   267 VLTQFNPLPRDD 278
            .| |..||.|||
 Frog   265 EL-QIIPLERDD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 110/245 (45%)
impa1NP_001017057.1 IMPase 9..254 CDD:238817 111/245 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 242 1.000 Domainoid score I2190
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4043
Inparanoid 1 1.050 250 1.000 Inparanoid score I3155
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm9498
Panther 1 1.100 - - LDO PTHR20854
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2586
SonicParanoid 1 1.000 - - X706
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.