DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and BPNT2

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_060283.3 Gene:BPNT2 / 54928 HGNCID:26019 Length:359 Species:Homo sapiens


Alignment Length:284 Identity:63/284 - (22%)
Similarity:97/284 - (34%) Gaps:75/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVASN-----LVSEAGRLIARNNEQRQDFVCKSNDIDLVTQTDKDVEQLLMDGIRRHFPEH--KF 69
            :|.||     |:..|...:..|.|:..|..              |.|.:|.|   ...||.  |.
Human   110 DVLSNRKMFYLLKTAFPSVQINTEEHVDAA--------------DQEVILWD---HKIPEDILKE 157

  Fly    70 IGEEESSGAEGVKKLTDEPTWIIDPVDGTMNFVHAF-PHSCISVGLKVNKVTELGLVYNPILEQR 133
            :...:...||.|      ..| |||:|.|..:.... .:....|.:.||....||:::.|..|..
Human   158 VTTPKEVPAESV------TVW-IDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYT 215

  Fly   134 FTARRGHGAFYNGRRIHVSGQKELGKALVTSEFGTTRDEAKMKVVHENFEKMAKKAHGLRV---- 194
            ..|....|:....|    |...|....:|.|     |..:.|      .:::|.:..|.:.    
Human   216 AWAMVDGGSNVKAR----SSYNEKTPRIVVS-----RSHSGM------VKQVALQTFGNQTTIIP 265

  Fly   195 LGSAALNMSMVALGAADANYE---FGIHA-----WDVCAGDLIVREAGGVVIDPAGGEFDI---- 247
            .|.|...: :..|...|.:.|   ..||.     ||:|||:.|::..||.:...:|.|...    
Human   266 AGGAGYKV-LALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTGSD 329

  Fly   248 -----------MSRRVLAAATPEL 260
                       |:.:.|....|:|
Human   330 GIEGGLLASIRMNHQALVRKLPDL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 61/277 (22%)
BPNT2NP_060283.3 IPPase 66..349 CDD:238818 61/278 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.