DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and CG17026

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster


Alignment Length:270 Identity:97/270 - (35%)
Similarity:144/270 - (53%) Gaps:13/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VEKCLEVASNLVSEAGRLIARNNEQRQDFVC-KSNDI-DLVTQTDKDVEQLLMDGIRRHFPEHKF 69
            :|:..:....|...||.::....:.....|. |..:. ::||..|..:|:.|::.|...:|:|||
  Fly     8 IEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKF 72

  Fly    70 IGEEESSGAEGV-KKLTDEPTWIIDPVDGTMNFVHAFPHSCISVGLKVNKVTELGLVYNPILEQR 133
            ||||::...:.| |:|||.|||||||:|||.||:...||..:|:||.:.|...||:|.||...:.
  Fly    73 IGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKL 137

  Fly   134 FTARRGHGAFYNGRRIHVSGQKELGKALVTSEF-----GTTRDEAKMKVVHENFEKMAKKAHGLR 193
            :||:.|.|||.||:.|.||..:.|..|.|..|.     ...|::...::.|     :...|..|.
  Fly   138 YTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYH-----VGSNARRLL 197

  Fly   194 VLGSAALNMSMVALGAADANYEFGIHAWDVCAGDLIVREAGGVVIDPAGGEFDIMSRRVLAAATP 258
            ...:...::.|||.|..||.:...::.||..||.|::|||||||..|.||.||||...::.|.|.
  Fly   198 AYSAVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTE 262

  Fly   259 ELAQEISKVL 268
            .|..||..::
  Fly   263 TLRAEIEHLI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 91/252 (36%)
CG17026NP_648820.1 IMPase 11..259 CDD:238817 91/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445182
Domainoid 1 1.000 47 1.000 Domainoid score I3498
eggNOG 1 0.900 - - E1_COG0483
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107379at33392
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - otm51346
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - P PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.