DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and IMPA2

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_055029.1 Gene:IMPA2 / 3613 HGNCID:6051 Length:288 Species:Homo sapiens


Alignment Length:273 Identity:128/273 - (46%)
Similarity:181/273 - (66%) Gaps:5/273 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EKCLEVASNLVSEAGRLIARNNEQRQDFVCKSNDIDLVTQTDKDVEQLLMDGIRRHFPEHKFIGE 72
            |:|.:.|..|...||::|.:...:.:....|::..||||:||..||.|::..:|..||.|:||.|
Human    17 EECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAE 81

  Fly    73 E-ESSGAEGVKKLTDEPTWIIDPVDGTMNFVHAFPHSCISVGLKVNKVTELGLVYNPILEQRFTA 136
            | .:|||:.|  ||..|||||||:|||.||||.||...:|:|..|.:..|.|::|:...|:.:|.
Human    82 EAAASGAKCV--LTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTG 144

  Fly   137 RRGHGAFYNGRRIHVSGQKELGKALVTSEFGTTRDEAKMKVVHENFEKMA-KKAHGLRVLGSAAL 200
            |||.|||.||:|:.|||:.:|.||||.:|.|..||.|.:|:...|.|::. .||||:||:||:.|
Human   145 RRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTL 209

  Fly   201 NMSMVALGAADANYEFGIHAWDVCAGDLIVREAGGVVIDPAGGEFDIMSRRVLAAATPELAQEIS 265
            .:..:|.|||||.|:||:|.||:.|..:|:|||||:|||.:||..|:|:.||:||:|.|:|..|:
Human   210 ALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIA 274

  Fly   266 KVLTQFNPLPRDD 278
            :.|...| ..|||
Human   275 QALQTIN-YGRDD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 116/246 (47%)
IMPA2NP_055029.1 IMPase 19..265 CDD:238817 117/247 (47%)
Substrate binding 103..106 1/2 (50%)
Substrate binding 205..207 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2217
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 250 1.000 Inparanoid score I3238
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm8602
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2586
SonicParanoid 1 1.000 - - X706
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.