DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and CG15743

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:280 Identity:57/280 - (20%)
Similarity:105/280 - (37%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VDVEKCLEVASNLVSEAGRL----IARNNEQRQDFVCKSND--IDLVTQTDKDVEQLLMDGIRRH 63
            |::.|.| :|:...::.|.|    :||:.:.::....|:::  .|..|..|.....::..|::|.
  Fly    55 VNLRKML-IAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRI 118

  Fly    64 FPEHKFIGEEESSGAEGVKKLTDEPT--------------------WIIDPVDGTMNF---VHAF 105
            ||..:...||:....:.......:||                    | :||:|.|..|   ::.:
  Fly   119 FPRVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVW-VDPLDATKEFTEELYEY 182

  Fly   106 PHSCISVGLKVNKVTELGLVYNPILEQRFTARRGH------------------GAFYNGRRIHVS 152
            ..:.:.|.:....:  :|::::|...|...|..|:                  .......|.|.:
  Fly   183 VTTMVCVAVAGRPI--IGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVSRSHTA 245

  Fly   153 GQKELGKALVTSEFGTTRDEAKMKVVHENFEKMAKKAHGLRVLGSAALNMSMVALGAADANYEFG 217
            |.|:|.:.:    ||            ||...:.....|.:||       .:||..|....:...
  Fly   246 GAKDLARGI----FG------------ENVSLLTAAGAGYKVL-------QVVANNATAYLHTSK 287

  Fly   218 IHAWDVCAGDLIVREAGGVV 237
            |..||:||||.|:...||.:
  Fly   288 IKKWDICAGDAILHALGGTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 55/275 (20%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 56/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.