DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9391 and impa2

DIOPT Version :9

Sequence 1:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002936126.2 Gene:impa2 / 100379805 XenbaseID:XB-GENE-1012262 Length:309 Species:Xenopus tropicalis


Alignment Length:273 Identity:128/273 - (46%)
Similarity:182/273 - (66%) Gaps:5/273 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EKCLEVASNLVSEAGRLIARNNEQRQDFVCKSNDIDLVTQTDKDVEQLLMDGIRRHFPEHKFIGE 72
            ::|:|.|..|...||::|.:...:.:....|::.:||||:||..||:|::..:|..||.|:||||
 Frog    38 KECMETAVQLALRAGQVIKKALTEEKRVSTKTSVVDLVTETDHFVEELIISALREKFPLHRFIGE 102

  Fly    73 EE-SSGAEGVKKLTDEPTWIIDPVDGTMNFVHAFPHSCISVGLKVNKVTELGLVYNPILEQRFTA 136
            |. |:|::.|  |||.|||||||:|||.||||.||...:|:|..||:..|.|::|:......:|.
 Frog   103 ESTSAGSKCV--LTDSPTWIIDPIDGTCNFVHRFPPVAVSIGFAVNRELEFGVIYHCTNGNMYTG 165

  Fly   137 RRGHGAFYNGRRIHVSGQKELGKALVTSEFGTTRDEAKMKVVHENFEKMAK-KAHGLRVLGSAAL 200
            |:|||||.|..|:||:.:..:..||:.:|.|..||.|.:|:...|.||:.| :|||:||:||:.|
 Frog   166 RKGHGAFCNEERLHVTNETGIRNALILTEIGPKRDPATLKLFLGNMEKLLKFQAHGIRVIGSSTL 230

  Fly   201 NMSMVALGAADANYEFGIHAWDVCAGDLIVREAGGVVIDPAGGEFDIMSRRVLAAATPELAQEIS 265
            .:..:|.|||||.|::|:|.||:.|..:|:|||||||||..||..|:||.||:||.|.||||.|:
 Frog   231 ALCHIASGAADAYYQYGLHCWDLAAATVIIREAGGVVIDTTGGPLDLMSCRVVAAGTTELAQSIA 295

  Fly   266 KVLTQFNPLPRDD 278
            :.| |.....|||
 Frog   296 QEL-QTIDYGRDD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9391NP_649294.1 IMPase 10..255 CDD:238817 115/246 (47%)
impa2XP_002936126.2 IMPase 40..285 CDD:238817 115/246 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 242 1.000 Domainoid score I2190
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 250 1.000 Inparanoid score I3155
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm9498
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2586
SonicParanoid 1 1.000 - - X706
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.