DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12975 and TRM112

DIOPT Version :9

Sequence 1:NP_649293.1 Gene:CG12975 / 40343 FlyBaseID:FBgn0037061 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_014444.1 Gene:TRM112 / 855782 SGDID:S000005329 Length:135 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:44/133 - (33%)
Similarity:74/133 - (55%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSTYNFLTSVAIKGVKV---GFPLKLTINKKEVVES---EFNPTFVERILPKLDWSAVYGAAQ 59
            ||..|.||| ..::|....   .|||:...:|.::|:.   ||||.|:..|:.::||.||...| 
Yeast     1 MKFLTTNFL-KCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVA- 63

  Fly    60 VAELTED-IPAVQP------ENIVENEL-LLQKLHHLLFEIDVLEGQLECPETGRVFPISDGIPN 116
             |||..: :|..:|      :.:.:::: :|..||.||.:..:.||:::|...|.::.|.:||||
Yeast    64 -AELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPN 127

  Fly   117 MLL 119
            :||
Yeast   128 LLL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12975NP_649293.1 Trm112p <90..113 CDD:281899 5/22 (23%)
TRM112NP_014444.1 Trm112-like 2..130 CDD:411041 41/130 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344458
Domainoid 1 1.000 52 1.000 Domainoid score I2849
eggNOG 1 0.900 - - E1_KOG1088
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1742
Isobase 1 0.950 - 0 Normalized mean entropy S1270
OMA 1 1.010 - - QHG54852
OrthoFinder 1 1.000 - - FOG0004467
OrthoInspector 1 1.000 - - oto98953
orthoMCL 1 0.900 - - OOG6_102098
Panther 1 1.100 - - LDO PTHR12773
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1543
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.