DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12975 and AT1G78190

DIOPT Version :9

Sequence 1:NP_649293.1 Gene:CG12975 / 40343 FlyBaseID:FBgn0037061 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_177943.1 Gene:AT1G78190 / 844155 AraportID:AT1G78190 Length:124 Species:Arabidopsis thaliana


Alignment Length:126 Identity:58/126 - (46%)
Similarity:77/126 - (61%) Gaps:4/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSTYNFLTSVAIKGVKVGFPLKLTINKKEVVESEFNPTFVERILPKLDWSAVYGAAQVAELTE 65
            |:|..:|.| |..||||...|||::...|..|.|.:|||.|:..:..|:||.|:...|:..|.||
plant     1 MRLIVHNML-SCNIKGVVNKFPLRIEAEKVTVKEVDFNPDFLRYMFAKIDWKALVDGARSMEYTE 64

  Fly    66 DIPAVQPE--NIVENELLLQKLHHLLFEIDVLEGQLECPETGRVFPISDGIPNMLLNEDEV 124
             :|...|:  .:..:|..|:|.||.|.|:.:.||.|.||||||.|.:|.|||||||:||||
plant    65 -LPDNAPDTTTLESDETFLRKFHHALLELHLEEGSLVCPETGRKFSVSKGIPNMLLHEDEV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12975NP_649293.1 Trm112p <90..113 CDD:281899 12/22 (55%)
AT1G78190NP_177943.1 Trm112-like 2..119 CDD:411041 51/118 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2952
eggNOG 1 0.900 - - E1_KOG1088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41132
Inparanoid 1 1.050 104 1.000 Inparanoid score I2135
OMA 1 1.010 - - QHG54852
OrthoDB 1 1.010 - - D1465773at2759
OrthoFinder 1 1.000 - - FOG0004467
OrthoInspector 1 1.000 - - otm3291
orthoMCL 1 0.900 - - OOG6_102098
Panther 1 1.100 - - O PTHR12773
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.