DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12975 and trmt112

DIOPT Version :9

Sequence 1:NP_649293.1 Gene:CG12975 / 40343 FlyBaseID:FBgn0037061 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001016673.1 Gene:trmt112 / 549427 XenbaseID:XB-GENE-1008424 Length:123 Species:Xenopus tropicalis


Alignment Length:123 Identity:55/123 - (44%)
Similarity:80/123 - (65%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSTYNFLTSVAIKGVKVGFPLKLTINKKEVVESEFNPTFVERILPKLDWSAVYGAAQVAELTE 65
            |||.|:|.|.| .:.||..||||.:...:.::...:||..||.|::|||:|.|:..||:......
 Frog     1 MKLLTHNMLRS-HVSGVTRGFPLLIRAEEVKLSAVDFNQDFVTRMIPKLEWGALVEAAESLGHGS 64

  Fly    66 DIPAVQPENIVENELLLQKLHHLLFEIDVLEGQLECPETGRVFPISDGIPNMLLNEDE 123
            |:|........:||..|:|:||:|.|::|:||.|:|||:|..|||:.||||||:||:|
 Frog    65 DLPRELETGYEKNEDFLKKVHHVLLEVEVIEGALKCPESGTEFPITRGIPNMLINEEE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12975NP_649293.1 Trm112p <90..113 CDD:281899 12/22 (55%)
trmt112NP_001016673.1 Trm112p <86..112 CDD:382359 14/25 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7695
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41132
Inparanoid 1 1.050 110 1.000 Inparanoid score I4742
OMA 1 1.010 - - QHG54852
OrthoDB 1 1.010 - - D1465773at2759
OrthoFinder 1 1.000 - - FOG0004467
OrthoInspector 1 1.000 - - oto102237
Panther 1 1.100 - - LDO PTHR12773
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1543
SonicParanoid 1 1.000 - - X4251
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.