DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12975 and Trmt112

DIOPT Version :9

Sequence 1:NP_649293.1 Gene:CG12975 / 40343 FlyBaseID:FBgn0037061 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001099800.1 Gene:Trmt112 / 293700 RGDID:1309710 Length:125 Species:Rattus norvegicus


Alignment Length:124 Identity:62/124 - (50%)
Similarity:86/124 - (69%) Gaps:3/124 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSTYNFLTSVAIKGVKV-GFPLKLTINKKEVVESEFNPTFVERILPKLDWSAVYGAAQVAELT 64
            |||.|:|.|:| .::||.. ||||:|...:..:...||||.||.|::||::|:|:..||....|.
  Rat     1 MKLLTHNLLSS-HVRGVGTRGFPLRLQATEVRINPVEFNPDFVARMIPKVEWAALVQAADTLNLA 64

  Fly    65 EDIPAVQPENIVENELLLQKLHHLLFEIDVLEGQLECPETGRVFPISDGIPNMLLNEDE 123
            | :|....|....:|..|:|:||:|.|:|||||.|:|||:||:||||.||||||||::|
  Rat    65 E-VPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESGRLFPISRGIPNMLLNDEE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12975NP_649293.1 Trm112p <90..113 CDD:281899 16/22 (73%)
Trmt112NP_001099800.1 Trm112-like 2..118 CDD:411041 57/117 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335619
Domainoid 1 1.000 102 1.000 Domainoid score I6739
eggNOG 1 0.900 - - E1_KOG1088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41132
Inparanoid 1 1.050 122 1.000 Inparanoid score I4658
OMA 1 1.010 - - QHG54852
OrthoDB 1 1.010 - - D1465773at2759
OrthoFinder 1 1.000 - - FOG0004467
OrthoInspector 1 1.000 - - oto95499
orthoMCL 1 0.900 - - OOG6_102098
Panther 1 1.100 - - LDO PTHR12773
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4251
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.