DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12975 and trm112

DIOPT Version :9

Sequence 1:NP_649293.1 Gene:CG12975 / 40343 FlyBaseID:FBgn0037061 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_592914.1 Gene:trm112 / 2541708 PomBaseID:SPAC31A2.02 Length:126 Species:Schizosaccharomyces pombe


Alignment Length:128 Identity:45/128 - (35%)
Similarity:76/128 - (59%) Gaps:6/128 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSTYNFL--TSVAIKGVKVGFPLKLTINKKEVVESEFNPTFVERILPKLDWSAVYGAA-QVAE 62
            |||.|.|||  ::.........|||.:...|..:.:.|..|.|:..|:|::||:|:.... |:..
pombe     1 MKLLTANFLNCSNKKCTSSPEAFPLDVVDAKLAIQQLELKPEFLIGIMPRIDWNALLKTTRQLGN 65

  Fly    63 LTEDIPAVQPENIVE-NELLLQKLHHLLFEIDVLEGQLECPETGRVFPISDGIPNMLLNEDEV 124
            .:  :|..:|:.:.: :|:||:.||::|.|.::.||::.|...|.|:||.:|||||||:|.|:
pombe    66 YS--LPDEKPDLVDDSDEVLLKSLHNVLLETEITEGKMVCGNCGHVYPIFEGIPNMLLSESEI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12975NP_649293.1 Trm112p <90..113 CDD:281899 8/22 (36%)
trm112NP_592914.1 Trm112p <89..115 CDD:281899 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3029
eggNOG 1 0.900 - - E1_KOG1088
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I1862
OMA 1 1.010 - - QHG54852
OrthoFinder 1 1.000 - - FOG0004467
OrthoInspector 1 1.000 - - oto100429
orthoMCL 1 0.900 - - OOG6_102098
Panther 1 1.100 - - LDO PTHR12773
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1543
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.