DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10508 and AT1G22250

DIOPT Version :10

Sequence 1:NP_001246859.1 Gene:CG10508 / 40342 FlyBaseID:FBgn0037060 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_173644.2 Gene:AT1G22250 / 838830 AraportID:AT1G22250 Length:200 Species:Arabidopsis thaliana


Alignment Length:95 Identity:19/95 - (20%)
Similarity:36/95 - (37%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 HGSSNASSYSSYSAS---MTSSSLVSSAQSNSSSIARRPAFESRARTKTDSLKHRQH------SL 628
            |||...|.......:   ..:::|......:.|::..:|..:.....||.|.....|      :|
plant    25 HGSFKRSKQGDQKQTKFEKNTTTLFFQRSKSDSAMLIKPDVQLHLEAKTQSETFEDHRTDLDLNL 89

  Fly   629 GNSHNSESAEFQSIIERMASLGPNSQLSKG 658
            ....:|.|:..::|:|:       .:.|||
plant    90 NLYSSSSSSVKKTIMEK-------DECSKG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10508NP_001246859.1 CUE 291..327 CDD:270465
AT1G22250NP_173644.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.