DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33054 and POA1

DIOPT Version :9

Sequence 1:NP_788553.1 Gene:CG33054 / 40340 FlyBaseID:FBgn0053054 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_009578.1 Gene:POA1 / 852310 SGDID:S000000226 Length:177 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:40/171 - (23%)
Similarity:69/171 - (40%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LSEVDGDLFSAPKTYS--LAHCVGADLAMGAGIAVQFKKVFGRLDE---LQAQQAGS---GDIAV 85
            ::.|.|::.. ||:|:  |.|....:.:.|.|||.|....:.:.::   ...::.||   |...:
Yeast     4 ITYVKGNILK-PKSYARILIHSCNCNGSWGGGIAYQLALRYPKAEKDYVEVCEKYGSNLLGKCIL 67

  Fly    86 L---KDDQRYIYYLVTKPQSWGKPTYESVQA----------SLEQMREHMRKNNVN--------- 128
            |   ::....|..|.|  .|:|..::...|:          .|:..||...|...:         
Yeast    68 LPSYENSDLLICCLFT--SSFGGSSHGEKQSILNYTKLALDKLKTFREAKDKTRTSEDSIGDYLN 130

  Fly   129 ----------KLAIPKIGCGIDGLEWEKVSGVLEENNGSFS 159
                      ||.:|:|..||.|:.|::...||||.:|..|
Yeast   131 GHIKYPIGEYKLEMPQINSGIFGVPWKETERVLEEFSGDMS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33054NP_788553.1 Macro_Poa1p_like 28..153 CDD:239230 36/163 (22%)
POA1NP_009578.1 YmdB 1..174 CDD:225021 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12521
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.