DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33054 and oard1

DIOPT Version :9

Sequence 1:NP_788553.1 Gene:CG33054 / 40340 FlyBaseID:FBgn0053054 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001018591.1 Gene:oard1 / 553793 ZFINID:ZDB-GENE-050522-480 Length:155 Species:Danio rerio


Alignment Length:120 Identity:61/120 - (50%)
Similarity:84/120 - (70%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDLFSAPKTYSLAHCVGADLAMGAGIAVQFKKVFGRLDELQAQQAGSGDIAVLKDDQRYIYYLVT 98
            ||||:.|.|.:||||:..|..|||||||.|||.|..::||:||:...|..|||:...|::|||||
Zfish    22 GDLFTCPPTDALAHCISEDCRMGAGIAVLFKKHFKGVEELKAQKRQPGQCAVLERSGRFVYYLVT 86

  Fly    99 KPQSWGKPTYESVQASLEQMREHMRKNNVNKLAIPKIGCGIDGLEWEKVSGVLEE 153
            |...:.|||.||::.||..|:||...|.||::::|:||||:|.:.||.||.::.|
Zfish    87 KKYYYQKPTSESLRKSLMSMKEHCLANGVNRVSMPRIGCGLDKMHWENVSSIITE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33054NP_788553.1 Macro_Poa1p_like 28..153 CDD:239230 60/118 (51%)
oard1NP_001018591.1 Macro_Poa1p_like 16..146 CDD:239230 61/120 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579242
Domainoid 1 1.000 103 1.000 Domainoid score I6732
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17038
Inparanoid 1 1.050 131 1.000 Inparanoid score I4610
OMA 1 1.010 - - QHG47785
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 1 1.000 - - otm25981
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - O PTHR12521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5559
SonicParanoid 1 1.000 - - X5787
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.