DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33054 and Oard1

DIOPT Version :9

Sequence 1:NP_788553.1 Gene:CG33054 / 40340 FlyBaseID:FBgn0053054 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001128068.1 Gene:Oard1 / 367214 RGDID:1308299 Length:158 Species:Rattus norvegicus


Alignment Length:68 Identity:31/68 - (45%)
Similarity:45/68 - (66%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LSEVDGDLFSAPKTYSLAHCVGADLAMGAGIAVQFKKVFGRLDELQAQQAGSGDIAVLKDDQRYI 93
            ::.|.||||:.|||.|||||:..|..|||||||.|||.||.:.||.:|:..:  :.::...:.|:
  Rat    14 ITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKRFGGVQELLSQRLDA--VWIVCSGKMYL 76

  Fly    94 YYL 96
            .:|
  Rat    77 QFL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33054NP_788553.1 Macro_Poa1p_like 28..153 CDD:239230 31/68 (46%)
Oard1NP_001128068.1 Macro 14..>62 CDD:294024 28/47 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 1 1.000 - - oto98412
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - O PTHR12521
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5787
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.