DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33054 and CG33056

DIOPT Version :9

Sequence 1:NP_788553.1 Gene:CG33054 / 40340 FlyBaseID:FBgn0053054 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_788556.1 Gene:CG33056 / 326246 FlyBaseID:FBgn0053056 Length:343 Species:Drosophila melanogaster


Alignment Length:128 Identity:65/128 - (50%)
Similarity:93/128 - (72%) Gaps:0/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQYTLSEVDGDLFSAPKTYSLAHCVGADLAMGAGIAVQFKKVFGRLDELQAQQAGSGDIAVLKDD 89
            |:..::|..|:|||||:.|:|.|.|.||.||.|||.:||:..||::|||:.|...:|::|||:.|
  Fly   157 PKCQITEARGNLFSAPENYALVHSVSADFAMCAGINLQFRCKFGQVDELKRQHKHTGNVAVLEQD 221

  Fly    90 QRYIYYLVTKPQSWGKPTYESVQASLEQMREHMRKNNVNKLAIPKIGCGIDGLEWEKVSGVLE 152
            .|:||.||||.:|..|.||.::..:|..||||||::.|.|||||::|||||.|:|.:|..:|:
  Fly   222 GRHIYNLVTKERSHEKCTYAALYYALLAMREHMREHGVTKLAIPRLGCGIDRLDWLRVRSLLD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33054NP_788553.1 Macro_Poa1p_like 28..153 CDD:239230 64/125 (51%)
CG33056NP_788556.1 Macro_Poa1p_like 5..136 CDD:239230
Macro_Poa1p_like 160..289 CDD:239230 64/125 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29TCN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - P PTHR12521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.