DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33054 and Oard1

DIOPT Version :9

Sequence 1:NP_788553.1 Gene:CG33054 / 40340 FlyBaseID:FBgn0053054 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001276419.1 Gene:Oard1 / 106821 MGIID:2146818 Length:152 Species:Mus musculus


Alignment Length:125 Identity:74/125 - (59%)
Similarity:94/125 - (75%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LSEVDGDLFSAPKTYSLAHCVGADLAMGAGIAVQFKKVFGRLDELQAQQAGSGDIAVLKDDQRYI 93
            ::.|.||||:.|||.|||||:..|..|||||||.|||.||.:.||.:||..||::||||.|.|||
Mouse    14 ITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKRFGGVQELLSQQKKSGEVAVLKRDGRYI 78

  Fly    94 YYLVTKPQSWGKPTYESVQASLEQMREHMRKNNVNKLAIPKIGCGIDGLEWEKVSGVLEE 153
            |||:||.::..|||||::|.|||.|:.|..||.|..|::|:||||:|.|:||.||.:|||
Mouse    79 YYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAILEE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33054NP_788553.1 Macro_Poa1p_like 28..153 CDD:239230 72/123 (59%)
Oard1NP_001276419.1 Macro_Poa1p-like 13..143 CDD:394873 74/125 (59%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9Y530 119..125 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835873
Domainoid 1 1.000 120 1.000 Domainoid score I5735
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17038
Inparanoid 1 1.050 155 1.000 Inparanoid score I4295
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47785
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 1 1.000 - - oto94910
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - O PTHR12521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5559
SonicParanoid 1 1.000 - - X5787
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.