DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10512 and CG17199

DIOPT Version :9

Sequence 1:NP_649289.2 Gene:CG10512 / 40339 FlyBaseID:FBgn0037057 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_650868.1 Gene:CG17199 / 42401 FlyBaseID:FBgn0038775 Length:461 Species:Drosophila melanogaster


Alignment Length:382 Identity:143/382 - (37%)
Similarity:208/382 - (54%) Gaps:39/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GFSITYRTMSAAAPKLVAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEM 142
            ||....:..|.    ||.|.|::||:...|.|::||:..|...||.|:|||:.|..|.|::||..
  Fly    84 GFKNATKDFSG----LVDVLEAQRFVSQVFSAMQVPKQAASEMADALIAADYMGQRSMGIHRLPS 144

  Fly   143 YINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWVCAKGSNH 207
            ...||...:..|.|.|.|:.|..|.|.|||.|..|.||.|:|||||::||:.||:|||.|:.||.
  Fly   145 IAADLLNCTVAGDATPGIVSEKKAIALVDGHNAPGPVVANFCMDLALQKAREVGIGWVSARSSNC 209

  Fly   208 YGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPLSLGANATNGDKFLLDMATTAVA 272
            .|.|.|||.:|::|.::|:.|||.:|.:.|....|..||.||::..|:..: ::|:.|....|.:
  Fly   210 IGFASWYACQALEQRMIGLCMTNAAPTLLPAGGIEPVLGENPIACAASGVH-EQFVADFGMAACS 273

  Fly   273 VGKIEIQRRKGAPLPDGWAQDPSGEVTNDAELGFSTGCLMPLGGSELTS---------------G 322
            |.::|:.      ..:||:::....|..|.            .|.|.||               .
  Fly   274 VDELELS------YCNGWSKEVPKLVALDR------------NGKETTSTEEALRAQRIRAFQPE 320

  Fly   323 YKGYGLGAMVDILSGVMSGANYSTQV-RKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFN 386
            :||:||.|.||||.|||:||.|:.|: |:..::..::.|:||||::|:||..|.|.||:|:|||:
  Fly   321 HKGFGLAAAVDILCGVMTGARYANQIQRRGVYSTENAPANLGQVYVAIDPMRFCPTFEDRLADFH 385

  Fly   387 SRLRGATPTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL 443
            ..||.|.|:...||.::.||||.:.|..||..||:......|.....||....|:||
  Fly   386 RLLRQAVPSKVGKPPMVPGDKELQHMKMVDEQGGLTMSSCTLSVLEELATEFDIEPL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10512NP_649289.2 PLN00105 100..432 CDD:215057 131/347 (38%)
Ldh_2 100..408 CDD:280734 123/323 (38%)
CG17199NP_650868.1 Ldh_2 100..412 CDD:280734 126/330 (38%)
PLN00105 101..420 CDD:215057 129/337 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448870
Domainoid 1 1.000 141 1.000 Domainoid score I217
eggNOG 1 0.900 - - E1_COG2055
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I231
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1122265at2759
OrthoFinder 1 1.000 - - FOG0008534
OrthoInspector 1 1.000 - - otm51429
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11091
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.